HORDB

General Information

ID: hor006260
Uniprot ID: Q14641
Protein name: Early placenta insulin-like peptide A chain
Gene name: INSL4
Organism: Homo sapiens (Human)
Family: Insulin family
Source: Human
Expression: Highly expressed in the early placenta. Expression of epil peptides in the villous cytotrophoblast is different from that displayed by the syncytiotrophoblast. In fetal tissues it was identified in the perichondrium of all four limbs, vertebrae, and ribs.
Disease: Diseases associated with INSL4 include Placenta Accreta and Chromosome 9P Deletion Syndrome.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0005159 insulin-like growth factor receptor binding; GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0007267 cell-cell signaling; GO:1901384 positive regulation of chorionic trophoblast cell proliferation
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

Sequence: SGRHRFDPFCCEVICDDGTSVKLCT
Length: 25
Propeptide: MASLFRSYLPAIWLLLSQLLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT
Signal peptide: MASLFRSYLPAIWLLLSQLLRESLA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: May play an important role in trophoblast development and in the regulation of bone formation.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: 10-15
Structure ID: AF-Q14641-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006260_AF2.pdb

hor006260_ESM.pdb

Physical Information

Mass:	321744	Formula:	C116H182N34O38S4
Absent amino acids:	AMNQWY	Common amino acids:	C
pI:	5.56	Basic residues:	4
Polar residues:	10	Hydrophobic residues:	6
Hydrophobicity:	-12.8	Boman Index:	-5408
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	54.4
Instability Index:	4274.4	Extinction Coefficient cystines:	250
Absorbance 280nm:	10.42

Literature

PubMed ID: 8666396
Title: Cloning of a new member of the insulin gene superfamily (INSL4) expressed in human placenta.
PubMed ID: 14702039
Title: Complete sequencing and characterization of 21,243 full-length human cDNAs.
PubMed ID: 15164053
Title: DNA sequence and analysis of human chromosome 9.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 15340161
Title: Signal peptide prediction based on analysis of experimentally verified cleavage sites.
PubMed ID: 9284764
Title: Identification of pro-EPIL and EPIL peptides translated from insulin-like 4 (INSL4) mRNA in human placenta.
PubMed ID: 9740319
Title: Insulin-like 4 (INSL4) gene expression in human embryonic and trophoblastic tissues.
PubMed ID: 12414911
Title: Transcriptional expression of genes involved in cell invasion and migration by normal and tumoral trophoblast cells.